Protein Info for MMP_RS02765 in Methanococcus maripaludis S2

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 24 to 172 (149 residues), 130.6 bits, E=3.3e-42

Best Hits

Swiss-Prot: 53% identical to Y352_THEMA: Uncharacterized ABC transporter ATP-binding protein TM_0352 (TM_0352) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to mmp:MMP0523)

MetaCyc: 42% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (1/7 steps found)

Sequence Analysis Tools

See Q6LZV0 at UniProt or InterPro

Protein Sequence (234 amino acids)

>MMP_RS02765 ABC transporter ATP-binding protein (Methanococcus maripaludis S2)
MYKIISLEDVWKIYQMGEVEVQALKGVSLDVNKGDFVAIVGSSGSGKSTMMNMIGCLDVP
TKGEVYLKSKNISNMNESELSELRGKTIGFVFQQYNLIPNMTALENVLLPLQIQEVNDST
AERSAERALKQVGLEDRMNNKPSQLSGGQQQRVSIARALACDPEIILADEPTGALDSATG
KEIINLFTALWESGKTIIMITHDQKLAKYAKTIVELKDGKIINIIDNKPNAVHE