Protein Info for MMP_RS02755 in Methanococcus maripaludis S2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 332 to 364 (33 residues), see Phobius details amino acids 376 to 400 (25 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 250 (230 residues), 110.1 bits, see alignment E=1.8e-35 PF02687: FtsX" amino acids 289 to 408 (120 residues), 72.8 bits, see alignment E=2.7e-24

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to mmp:MMP0521)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZV2 at UniProt or InterPro

Protein Sequence (415 amino acids)

>MMP_RS02755 ABC transporter permease (Methanococcus maripaludis S2)
MKPLKLFNMASKMVKSSKLRSWITILGIVIGIASVIAIISAGDYLSTSVSDQLNDMLSDE
ITLTASAAQGSDDDEDPELTDMDVLILNGISDIEYVDVRVSTRNEVRFAGGRETATITGV
DPAVWSQMTDEELSAGRLLQASDSNAVIISYYTATEAFDREIGINQMITIGNKQFKVVGI
LEEDETQGFGQMGGMSSNTVYMPYEAVYTLELDDDASYSISEKEEGVYDEIIFTLYEDVN
QTTALENIQKKLMMSRHVNEDNMDFTIRSPTVFEGPEQIISMLTTFLSFIAGISLIVGVT
GISNTMFTTVLEKTREIGIMKAIGAKNKDIMLLFVFNSAIIGLVGGFLGLVLGTILSQII
VWFIAQSMDSSYQFVLSIKSVVIAIGCSLAAGIIAGIIPAYNASKLKPVEALRSE