Protein Info for MMP_RS02730 in Methanococcus maripaludis S2

Annotation: ModD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01334: modD protein
  • amino acids 4 to 279 (276 residues), 224.5 bits, E=8.9e-71
• PF02749: QRPTase_N
  • amino acids 20 to 104 (85 residues), 72.5 bits, E=2.4e-24
• PF01729: QRPTase_C
  • amino acids 108 to 268 (161 residues), 108.3 bits, E=3.6e-35

Best Hits

KEGG orthology group: K03813, molybdenum transport protein [EC: 2.4.2.-] (inferred from 100% identity to mmp:MMP0516)

Predicted SEED Role

"Molybdenum transport system protein ModD" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

See Q6LZV7 at UniProt or InterPro

Protein Sequence (283 amino acids)

>MMP_RS02730 ModD protein (Methanococcus maripaludis S2)
MSFYIPDYELEKIIEEDINPLDLTSQIMKLDRFNAKLAYKARHDMVLCCTEEAERICKIL
GLEVISYKRTGSYVKEGEVFFEAKGRADNVHLAWKSVLRLLEGYCGMATRTYEFVTLARK
YNENTNVVTTRKNLAGTKKPTIKAIVAGGAYPHRLGLSETILIFDEHLAFVDGDEELKCV
LKEMKANALEKKIGIEVDNFETGIKYVKMGFDYIQLDKVDSKTVEKFVKAAKEINPNITI
VAAGGITIQNIEEYAKTGAEVIVTSALYFGKAADIKTIIEKID