Protein Info for MMP_RS02680 in Methanococcus maripaludis S2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details TIGR01581: NifC-like ABC-type porter" amino acids 30 to 251 (222 residues), 243.7 bits, see alignment E=1.7e-76 TIGR02141: molybdate ABC transporter, permease protein" amino acids 53 to 256 (204 residues), 196.7 bits, see alignment E=3.6e-62 PF00528: BPD_transp_1" amino acids 66 to 254 (189 residues), 54.9 bits, see alignment E=5e-19

Best Hits

Swiss-Prot: 32% identical to CYST_SALTY: Sulfate transport system permease protein CysT (cysU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to mmp:MMP0506)

MetaCyc: 30% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZW7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>MMP_RS02680 ABC transporter permease (Methanococcus maripaludis S2)
MKNNDFLKFFSLFALSVFILFILMIVMSIVTNISFETFYDSLFSKEIQFAIKLSLETASI
ATILGTLLGVPAAYALARYNFKGKDIVDSIVELPVILPPLITGFALLVFFGNTVFGKFIT
ENIIEILFTYKGTIVAQFFVATPFIIRTSKSVFECIDEKYELIAQSLGSKKYESFLDVVI
PMAKNGIIAGAILAWARSIGEFGATMMLAGATKMKTETLPIAVFLNISLGDLEKALAVSL
IFLLVATLVLVIIRSVLKIGENNDRL