Protein Info for MMP_RS02585 in Methanococcus maripaludis S2

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details PF14827: dCache_3" amino acids 48 to 275 (228 residues), 62.3 bits, see alignment E=1.4e-20 PF17201: Cache_3-Cache_2" amino acids 172 to 295 (124 residues), 71.9 bits, see alignment E=1.4e-23 PF17202: sCache_3_3" amino acids 189 to 290 (102 residues), 105.6 bits, see alignment E=4.3e-34 PF00672: HAMP" amino acids 314 to 363 (50 residues), 44.4 bits, see alignment 4.1e-15 PF00015: MCPsignal" amino acids 500 to 680 (181 residues), 109.4 bits, see alignment E=4.6e-35

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to mmp:MMP0487)

Predicted SEED Role

"methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZY6 at UniProt or InterPro

Protein Sequence (729 amino acids)

>MMP_RS02585 methyl-accepting chemotaxis protein (Methanococcus maripaludis S2)
LKISFKKIGTKLLIFMILCAIIPLMVVGGVSTNKITEEMQIQGDNSVNDNLNIFQESIEN
VIVEFETTTSYTASLDTFSELLVNDDKEVLYDFAEKMKKSSEVDLVAFTDKNGNIISSSD
NVQTNLKPVISKLLSNEVQSSFEIISGSEASKYSDYKVNNINDALAICVVAPVYHSGELV
GTVTLVDIVNNDDYWVDSLKERTGNEATIFLKNVRISTTVQTNGQDATGTKCSDEVYNII
TNHQDYVGTANVLGSEYITKYSPIEDKDGNVVGIIFTGIPKAPFVAVITDTRNEIIIISL
LGLLLSILIALYTGRKITKPIEELKKGTEEFGNGNYDYKTTVKTGDELQELSDSFNKMAE
NVKNLMKTMDMDKVELATLLTNVSDVMNRVAKGDFTARADESRENNNLEKAINTAVSNVA
DLIKELREEVELLNIQIQKVEDELKGAEETATQVAEAATQVAEAASDQSAKLQESSEELE
NTYEGAKEVYSAAEETVKSSEEIKENSETGVEKVENAISRMQSITNVIDELGKSIKMLGE
DGKKINEVTGLIKDIAEQTGLLALNASIEAARAGDAGKGFAVVASEIKSLAEEIKKSVED
INHTIEGVNKRIDDTIDLGLKGKDEVDKGVIAIDEVNDALLKIKESVNESAVKINGIKHG
AQNASENTEGALKNAQEIAALSEEFTATAEEVTASTEELNSIIEEIRGIAEEVTQVAERV
TKKSSQFKI