Protein Info for MMP_RS02510 in Methanococcus maripaludis S2

Annotation: site-specific integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF13495: Phage_int_SAM_4" amino acids 29 to 106 (78 residues), 52.8 bits, see alignment E=4.2e-18 PF00589: Phage_integrase" amino acids 149 to 315 (167 residues), 115.4 bits, see alignment E=2.5e-37

Best Hits

Swiss-Prot: 54% identical to Y367_METJA: Probable integrase/recombinase protein MJ0367 (MJ0367) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 100% identity to mmx:MmarC6_0418)

Predicted SEED Role

"Probable integrase/recombinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M001 at UniProt or InterPro

Protein Sequence (328 amino acids)

>MMP_RS02510 site-specific integrase (Methanococcus maripaludis S2)
MDVVSKFLVGAGKRDAVTKTPAMNKWISVFREEREFDGIKENTIIGDLTKLGVFLEFAQQ
RLEKEPDELYKTDFIKFFNYLEKERKISKNTQNRYFNLLKVFYRAFKLDNFMDFRDESNE
RKRFSSSRIEVKHYDAITEQDLNLVIAKIFENQSSTKIRDLVVIRMLWDTGARVSEVLNL
KYEDCDFENGEFRLRNTKSHEERKVVCSSDTLELLKCLASYNFKKEPKDYLFQSTNQENL
GKIADRNQITRTFGRAVDKLKEEEKIQQNKRYVVHSLRHGRAVDLLNKGVPIDVVKEILG
HRSLETTLYYSHSRQRKEQMLQDIKKLL