Protein Info for MMP_RS02470 in Methanococcus maripaludis S2

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF13463: HTH_27" amino acids 13 to 75 (63 residues), 23.8 bits, see alignment E=4.5e-09 PF03551: PadR" amino acids 15 to 80 (66 residues), 28 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 43% identical to Y944_METJA: Uncharacterized protein MJ0944 (MJ0944) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmx:MmarC6_0443)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M008 at UniProt or InterPro

Protein Sequence (120 amino acids)

>MMP_RS02470 helix-turn-helix transcriptional regulator (Methanococcus maripaludis S2)
MILKLLAKKYVREILEMIEENEELYFSEIMNNLDTHQGSVGRLLSEMVEYDLLSKREDEE
GKKLNKTYYSITEHGKLALKIYEYSDKLENIRESKFKMEIKGGKNTNIQTEHLDLKIEYK