Protein Info for MMP_RS02445 in Methanococcus maripaludis S2

Annotation: putative DNA binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF04326: SLFN_AlbA_2" amino acids 17 to 120 (104 residues), 78.8 bits, see alignment E=1.5e-25 PF13749: HATPase_c_4" amino acids 284 to 364 (81 residues), 67.3 bits, see alignment E=2.9e-22 PF08279: HTH_11" amino acids 386 to 428 (43 residues), 28.9 bits, see alignment 2.6e-10 PF08220: HTH_DeoR" amino acids 386 to 432 (47 residues), 24.5 bits, see alignment 5.5e-09 PF13412: HTH_24" amino acids 389 to 430 (42 residues), 34.3 bits, see alignment 4.2e-12

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to mmp:MMP0460)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M013 at UniProt or InterPro

Protein Sequence (447 amino acids)

>MMP_RS02445 putative DNA binding domain-containing protein (Methanococcus maripaludis S2)
VTKLTKKQVTDLINTGEGYTLEFKESLNASLAKEICAFANSDGGHILLGVTDSGDITGYP
LSNQDDARITDIARNMDPSFSVNLEKVDNVVVITVPKGENKPYSTGGLYYVRNGSQSQKL
KREEVIELFKYNGLISFEEIPNKEFDLKKDLNNSALNNFITASGITNKLKKEDLLNNLYL
LKDGFLKNAGVLYFCNNSTKFFRNAHITCVLYEGTSKSNILDRKDFSKDIYSNFNDSFDY
ICSKLNTEYIIGKERVERLELPKEAIREALVNSIAHRDYFSSGHIQVDIFQDKLEISNPG
GLVLGLSYSELGKRSIPRNPLLADLMLRSKLVERVGSGIIRIRESMESYGLNCEFNVSEN
YFSTVLGRKKGFKFPVSFSSTNAVSRSDKIIALIMENPEITILEISKLLNLSHSTVRNEI
KVLKENGIVKRVGPTKGGHWEVVDTKK