Protein Info for MMP_RS02410 in Methanococcus maripaludis S2

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 34 to 246 (213 residues), 164.5 bits, E=4e-52
• PF10613: Lig_chan-Glu_bd
  • amino acids 49 to 126 (78 residues), 30.6 bits, E=4.8e-11
• PF09084: NMT1
  • amino acids 68 to 194 (127 residues), 40.2 bits, E=5.5e-14

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to mmp:MMP0455)

Predicted SEED Role

No annotation

Sequence Analysis Tools

See Q6M018 at UniProt or InterPro

Protein Sequence (248 amino acids)

>MMP_RS02410 ABC transporter substrate-binding protein (Methanococcus maripaludis S2)
MKKICFLMAIVLILAISACISLPSEQITIKTGTLSVGVFKHAPPAVYGQNGELIGFEVEL
VSEIAKRMNLNVEFKEYMFSNLLNAVANNEIDCAISDISISPEREKIVSFTRAYSHTELV
VLVRKESGIRTITDLNGKKIGVVDDTIHETKAKSLQKSMDFEIIEYETPIELYNDLNNGK
IDATISEMDNFKVSSYMDQLELIDTLEILYSGIAVNKNNKELLHEMDRVLLELETEGYIE
ELKQKWSN