Protein Info for MMP_RS02385 in Methanococcus maripaludis S2

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF10609: ParA" amino acids 3 to 43 (41 residues), 32.2 bits, see alignment 3.5e-11 PF01656: CbiA" amino acids 3 to 259 (257 residues), 57.4 bits, see alignment E=6.8e-19 PF12837: Fer4_6" amino acids 62 to 85 (24 residues), 24.8 bits, see alignment (E = 7.1e-09) PF00037: Fer4" amino acids 63 to 86 (24 residues), 28.6 bits, see alignment (E = 4.2e-10) amino acids 94 to 115 (22 residues), 26.2 bits, see alignment (E = 2.3e-09) PF13187: Fer4_9" amino acids 70 to 114 (45 residues), 30.6 bits, see alignment 1.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0450)

Predicted SEED Role

"MinD superfamily P-loop ATPase containing an inserted ferredoxin domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M023 at UniProt or InterPro

Protein Sequence (285 amino acids)

>MMP_RS02385 ATP-binding protein (Methanococcus maripaludis S2)
MNISILSGKGGTGKTTISTNLSILLSENHENVSYFDFDVEEPNGFIFLKPEIEIENKVFK
KVPKIDKELCTNCGECSKLCKFNAISITPNNSTVFEKLCHDCGLCYIACPVQAISEILRE
IGKIESGKSKDIPNLNAFRGVLNIGEPSGVPVISALKKFLDVNSINILDAPPGSSCSVIN
TVEDSDYSILVTEPTKFGLHDLKIAVEVLRYLNIPFGVLINKSDEFDCIIENYCENEKID
ILGKIPFSRNIANKYSKGDILINSDAEFTENLQNIASELEKRSIL