Protein Info for MMP_RS02345 in Methanococcus maripaludis S2

Annotation: GTP-dependent dephospho-CoA kinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF04019: DUF359" amino acids 37 to 156 (120 residues), 131.8 bits, see alignment E=5.8e-43

Best Hits

Swiss-Prot: 100% identical to Y442_METMP: UPF0218 protein MMP0442 (MMP0442) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09735, hypothetical protein (inferred from 98% identity to mmq:MmarC5_1195)

Predicted SEED Role

"UPF0218 protein MJ0395"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M030 at UniProt or InterPro

Protein Sequence (158 amino acids)

>MMP_RS02345 GTP-dependent dephospho-CoA kinase family protein (Methanococcus maripaludis S2)
MYLLNDKVAHELKKPFGKVYKELPSIEGKVVSIGDVTTKHLLSNGIIPDLSILDFKTKRN
IPVDIPHKFKTIFEVENPQGCISDEAIERIKYLSTIHDRDMALIIKGEEDLLTIPVIKYF
PEDTSVIYGQPDEGMVLLKITDELKQKIEKLLKEMEER