Protein Info for MMP_RS02290 in Methanococcus maripaludis S2

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF00753: Lactamase_B" amino acids 14 to 166 (153 residues), 51.8 bits, see alignment E=2.6e-17 PF16661: Lactamase_B_6" amino acids 19 to 179 (161 residues), 32.3 bits, see alignment E=1.7e-11 PF12706: Lactamase_B_2" amino acids 25 to 177 (153 residues), 34.7 bits, see alignment E=3.5e-12 PF10996: Beta-Casp" amino acids 233 to 345 (113 residues), 73.5 bits, see alignment E=5.4e-24 PF07521: RMMBL" amino acids 358 to 411 (54 residues), 35.1 bits, see alignment 2.8e-12

Best Hits

Swiss-Prot: 53% identical to Y047_METJA: Uncharacterized protein MJ0047 (MJ0047) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07577, putative mRNA 3-end processing factor (inferred from 100% identity to mmp:MMP0431)

Predicted SEED Role

"Protein similar to polyadenylation specificity factor, MJ0047 type"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M041 at UniProt or InterPro

Protein Sequence (433 amino acids)

>MMP_RS02290 MBL fold metallo-hydrolase (Methanococcus maripaludis S2)
MELYFRGGASEVGRSCVELKTEKSTVLFDCGVKLSHEESEYPILDNLNADCVFASHAHLD
HTGGIPLLIRKGMVPAIYATEVTKAISKELLRDSIKIAGAEGQDIPYDKADVNKSLNLFR
KARYNHPKDFKDFEFEFFNAGHIPGSSTISLNYGGKRVVYTGDTKVSDTDLVKGADLSYT
KEDIACLIVESTYGDKNQENREDAEKNFINKIKETLERGGIPLVPVFAVDRSQEILMILN
KHDFGVPVYFDGMGRKITRIMLQYPKFLNHPDDLKAAFLNVIEVESKDRPKIIKDIKQNG
GIIVSTAGMLEGGPIIPYIHEFMEDPKNSLIFTGYQVEETAGRKLLETGKIEIGEFDIEP
KLEIASYQFSAHGEMDELREIVKKANPEVLVIQHGEEEVVKIFKDWAVSQGFNENSVFTP
KIGDKIKLTEFLK