Protein Info for MMP_RS02230 in Methanococcus maripaludis S2

Annotation: sodium-dependent transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 84 to 110 (27 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 177 to 203 (27 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 254 to 280 (27 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details amino acids 458 to 480 (23 residues), see Phobius details PF00209: SNF" amino acids 3 to 117 (115 residues), 135.6 bits, see alignment E=1.1e-43 amino acids 126 to 474 (349 residues), 254.8 bits, see alignment E=8.7e-80

Best Hits

Swiss-Prot: 55% identical to Y1319_METJA: Uncharacterized sodium-dependent transporter MJ1319 (MJ1319) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03308, neurotransmitter:Na+ symporter, NSS family (inferred from 100% identity to mmp:MMP0419)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M052 at UniProt or InterPro

Protein Sequence (503 amino acids)

>MMP_RS02230 sodium-dependent transporter (Methanococcus maripaludis S2)
MAREQWASKMGFILAAVGSAVGLGNIWRFPYMAYENGGGAFLIPYFVALLFVGIMVMVLE
LALGHSTKGSAPLALRRLGKNFEWIGWLAIATAFIITTYYTAIIAWALVYLVKLFMVGFP
TDFGGFFFSDILALSSGHGDLGGFNLPILVGLALIWGVNYIVVNSGVRKGLEKANEILMP
VLFFLILALVVRSITLPGGLMGIEYYLTPNFAVLLTPKVWIDAFSQIFFTLSLGFGIMVA
YSSYLPKKSDLTASAFTISLMNCGFSFLAGFAVFGTLGYMAMTQGVPISEVVTQSIGLAF
VAFPQALSLMPGGIILAAIFFIALFVAGISSSVSLVESTASAVIDKFNLPRHKAASAVIA
TSFFASLIYATNAGLYWLDSVDHYINWFTIPLVAVLEIIVSIWIFKGSKLEKYIDNLSEY
NLGSFWKFFAGIFSPLFLIYMILNGAWTELTLGYEGYAPIFLLLSLGIPVFGLVVSLIMP
MIPWIDKGREIEEWDEFVKKDEE