Protein Info for MMP_RS02220 in Methanococcus maripaludis S2

Annotation: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase" amino acids 3 to 232 (230 residues), 286.9 bits, see alignment E=6.2e-90 PF00977: His_biosynth" amino acids 3 to 228 (226 residues), 275.2 bits, see alignment E=1e-85 PF01207: Dus" amino acids 60 to 123 (64 residues), 25 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 100% identical to HIS4_METMP: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 100% identity to mmp:MMP0417)

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.16

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62357 at UniProt or InterPro

Protein Sequence (241 amino acids)

>MMP_RS02220 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (Methanococcus maripaludis S2)
VLVIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVNEGAEMLHLVDLDGALDGKR
VNDEFIEEIIKKSGVPVQIGGGIRSIEDAEYLVEKGAKKVIIGTIAVENPEIIKELSKRI
GSEKIMVSLDAKDGKVVIKGWKEKTKYTPVQIGKILEEMGAGSILFTNVDSEGLLNGINI
EPTKELVDNLKIPIVASGGVTTIDDLLKLKEIGVYGVVVGSAIYKNMINLKDAIEAVNKS
N