Protein Info for MMP_RS02195 in Methanococcus maripaludis S2

Annotation: tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR01578: MiaB-like tRNA modifying enzyme, archaeal-type" amino acids 2 to 424 (423 residues), 457.1 bits, see alignment E=5.5e-141 PF00919: UPF0004" amino acids 2 to 90 (89 residues), 73.7 bits, see alignment E=1.5e-24 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 2 to 421 (420 residues), 398 bits, see alignment E=5e-123 PF04055: Radical_SAM" amino acids 147 to 316 (170 residues), 83.1 bits, see alignment E=4e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0412)

Predicted SEED Role

"tRNA N6-threonylcarbamoyladenosine 2-methylthiotransferase (putative) @ tRNA-i(6)A37 methylthiotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M059 at UniProt or InterPro

Protein Sequence (425 amino acids)

>MMP_RS02195 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase (Methanococcus maripaludis S2)
LKIYIEGYGCTLNTADTQIIKNSVNEFEDFELTDNVDDSDIIVINTCIVRQETEHRMISR
IEYFKSLDKKVVVAGCMAKALSKKIENLADVLIMPREAQHSGNILKDKLLKDFSEKNNES
TQNLNFEDKLNEKIKKVSSQGLITALPICEGCLGSCTYCIVKRARGNLASYDRDLIVKKA
EELVKSGTKCLLVTAQDTACYGLDNNDSLPNLINDISEIPEKFAMRIGMMHAKFAEPILD
ELIESFKSEKVVKFLHLPIQSGDDQVLKDMNRNYTVDEYISVLNEFKSKIKNLNFTTDVI
VGFPTETEEAFENTLEIVKKIKPDFTHAAKYSQRKYTKAAILKQVDTKIRKERSEILNEL
RRELSYENNKRHIGETFEILVTKDNMGVTDNCKNVIFEEPAKIGEFKRVKITGAKTFGLS
GKLIN