Protein Info for MMP_RS02190 in Methanococcus maripaludis S2

Annotation: sulfopyruvate decarboxylase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF02776: TPP_enzyme_N" amino acids 1 to 100 (100 residues), 35.6 bits, see alignment E=3.6e-13 TIGR03845: sulfopyruvate decarboxylase, alpha subunit" amino acids 4 to 163 (160 residues), 242 bits, see alignment E=1.3e-76

Best Hits

Swiss-Prot: 100% identical to COMD_METMP: Sulfopyruvate decarboxylase subunit alpha (comD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06034, sulfopyruvate decarboxylase subunit alpha [EC: 4.1.1.79] (inferred from 99% identity to mmx:MmarC6_0499)

MetaCyc: 64% identical to alpha subunit of sulfopyruvate decarboxylase (Methanocaldococcus jannaschii)
Sulfopyruvate decarboxylase. [EC: 4.1.1.79]

Predicted SEED Role

"Sulfopyruvate decarboxylase - alpha subunit (EC 4.1.1.79)" (EC 4.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.79

Use Curated BLAST to search for 4.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M060 at UniProt or InterPro

Protein Sequence (167 amino acids)

>MMP_RS02190 sulfopyruvate decarboxylase subunit alpha (Methanococcus maripaludis S2)
MNASEAVYKAILDSGVDFVTSVPCANLKTVLNYLNDDKDIQHIPVTREEEGIGVCTGAYL
GGRKTALLMQNSGLGNSINAIGSLVKVYKIPILIIISHRGDLKEKISAQIPMGQWTKKLL
ETVEIPYFSPKTPDEAYKLIKDASELSINMEYPVAILLDALYWEHDK