Protein Info for MMP_RS02130 in Methanococcus maripaludis S2

Annotation: zinc metalloprotease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 47 (18 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details PF01435: Peptidase_M48" amino acids 64 to 277 (214 residues), 132.6 bits, see alignment E=7.9e-43

Best Hits

Swiss-Prot: 60% identical to HTPX_METJA: Protease HtpX homolog (htpX) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 100% identity to mmp:MMP0399)

Predicted SEED Role

"Peptidase M48, Ste24p precursor"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M072 at UniProt or InterPro

Protein Sequence (285 amino acids)

>MMP_RS02130 zinc metalloprotease HtpX (Methanococcus maripaludis S2)
MMSTVKVLLLMALLTGMIYGICYMLGFPPIFAILLALIPNLISYFYSDKIVLTSYGAKIV
DENEAPNLHRIVESIANRANIQKPKVAIINTDTPNAFATGRSPKNGVVAVTTGILQLLNE
QELEGVLAHEIGHIKHRDILIGTIVATMAGAIMYIANFLQWGMLFGYGRDDDGNPLQIVA
SLLFIILAPIAAMVVQFAISRQNEYNADENGAKYSNPIYLANALTKLEKGVKYHPLRNGS
PATAHMFIVNPFKAGNVARLFSTHPSTEERVKRLMEMASNPKYLR