Protein Info for MMP_RS02085 in Methanococcus maripaludis S2

Annotation: inosine/xanthosine triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 TIGR00258: inosine/xanthosine triphosphatase" amino acids 50 to 214 (165 residues), 172.5 bits, see alignment E=4.2e-55 PF01931: NTPase_I-T" amino acids 51 to 209 (159 residues), 179.6 bits, see alignment E=2.1e-57

Best Hits

Swiss-Prot: 54% identical to NCPP_METJA: Probable inosine/xanthosine triphosphatase (MJ0261) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0390)

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M081 at UniProt or InterPro

Protein Sequence (219 amino acids)

>MMP_RS02085 inosine/xanthosine triphosphatase (Methanococcus maripaludis S2)
MFESRFCDICGKPAKTYQFGSLLCEDPECLKKAQKLRGGPAGHKLRVISVGSTNPVKVSA
VEKAIEKTVGTMLVSSVDTKSGVSDQPQGFEETFKGAYNRAKGAFEKVNCVYGIGIEAGI
VEIGEKKLDIHICVVYNGLDYSVGTSQAFQIPKDISDMINEGYECSKIAEETYRVKNIGQ
KNGIIGVLTDNNILREQLCIDSVVMAMIPKYRRNSQIRF