Protein Info for MMP_RS01985 in Methanococcus maripaludis S2

Annotation: F420-dependent methylenetetrahydromethanopterin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to MTD_METMP: F420-dependent methylenetetrahydromethanopterin dehydrogenase (mtd) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00319, methylenetetrahydromethanopterin dehydrogenase [EC: 1.5.99.9] (inferred from 100% identity to mmp:MMP0372)

MetaCyc: 60% identical to F420-dependent methylenetetrahydromethanopterin dehydrogenase (Archaeoglobus fulgidus DSM 4304)
1.5.99.9-RXN [EC: 1.5.98.1]

Predicted SEED Role

"F420-dependent methylenetetrahydromethanopterin dehydrogenase (EC 1.5.99.9)" in subsystem Methanogenesis or One-carbon metabolism by tetrahydropterines (EC 1.5.99.9)

MetaCyc Pathways

methyl-coenzyme M oxidation to CO₂ II (6/6 steps found)
factor 420 biosynthesis I (archaea) (5/5 steps found)
methyl-coenzyme M oxidation to CO₂ I (5/6 steps found)
3PG-factor 420 biosynthesis (4/5 steps found)
factor 420 biosynthesis II (mycobacteria) (4/6 steps found)
methoxylated aromatic compound degradation II (6/9 steps found)

KEGG Metabolic Maps

Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.5.99.9

Use Curated BLAST to search for 1.5.98.1 or 1.5.99.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M099 at UniProt or InterPro

Protein Sequence (277 amino acids)

>MMP_RS01985 F420-dependent methylenetetrahydromethanopterin dehydrogenase (Methanococcus maripaludis S2)
MVVKIGILKCGNIGMSPVVDLCLDERADRNDIDVRVLGSGAKMGPEQVEEVAKKMVEEIK
PDFIVYIGPNPAAPGPKKAREILSAGGIPAVIIGDAPGIKDKDAMAEEGLGYVLIKCDPM
IGARRQFLDPVEMAMFNADVIRVLAGTGALRVVQNAIDDMVFAVEEGKEIPLPKIVITEQ
KAVEAMDFANPYAKAKAMAAFVMAEKVADIDVKGCFMTKEMEKYIPIVASAHETIRYAAK
LVDEARELEKATDAVSRKPHAGAGKILNKCKLMEKPE