Protein Info for MMP_RS01980 in Methanococcus maripaludis S2

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 69 to 85 (17 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details PF03458: Gly_transporter" amino acids 9 to 81 (73 residues), 73.1 bits, see alignment E=6.9e-25 amino acids 97 to 168 (72 residues), 74 bits, see alignment E=3.5e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0371)

Predicted SEED Role

"FIG00719453: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0A0 at UniProt or InterPro

Protein Sequence (209 amino acids)

>MMP_RS01980 trimeric intracellular cation channel family protein (Methanococcus maripaludis S2)
MITENIFFIMNIIGLLAFAVVGALKGIKKGLDLLGIIVLGIMTALGGGITRDLLVNTIPY
ALRSPNDMGVALIGVWCAIVIFKVFNEDVSNKYIIQIPDAVGLSAFTTTGAMIAYNFDVS
FFGIIILATLTGVGGGIISDILLQKTPSALTEDFYASCSIIGAIAFYLAILSNLSLEMSA
VICSIVVLMIRIVAILCKWSLPKFYSEQK