Protein Info for MMP_RS01945 in Methanococcus maripaludis S2

Annotation: DUF4350 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 24 (2 residues), see Phobius details amino acids 256 to 272 (17 residues), see Phobius details PF14258: DUF4350" amino acids 35 to 216 (182 residues), 113.8 bits, see alignment E=5.6e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0364)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0A7 at UniProt or InterPro

Protein Sequence (332 amino acids)

>MMP_RS01945 DUF4350 domain-containing protein (Methanococcus maripaludis S2)
MEKYFKYILIALLGVIFVSLPAGVPMIKSFSEYSSFNTDWNGCSKFTKMVYDSEIIVTPI
YSPYDDYNFDKNGVLFIIGPEIDFSNSEIQKIGNFVKCGNTLVIADDFGTSNQILEQLNL
TDKFTKKRLNDLFYTSNENLIEYKVPEEYGSGYIVTNIPTYTSKIGFVTASNFSNSNLKN
QNPALISKVYYENGNIILIGDPDIFTNGLYNYNKNFLKDFTEKLNSNHVYIDEIHHKDFG
YEISVFYVHKSVPKKLILIVLLLLVCSFHVQNKKVFNNATKKLISKFSKKGTENEEEILK
NISEKHDIDLNDLKRVINNIKDGNNGRKRISK