Protein Info for MMP_RS01895 in Methanococcus maripaludis S2

Annotation: flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 381 to 405 (25 residues), see Phobius details PF01943: Polysacc_synt" amino acids 10 to 272 (263 residues), 69.4 bits, see alignment E=5.3e-23 PF13440: Polysacc_synt_3" amino acids 42 to 324 (283 residues), 45.5 bits, see alignment E=9.6e-16 PF03023: MurJ" amino acids 156 to 403 (248 residues), 27.7 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0354)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0B7 at UniProt or InterPro

Protein Sequence (411 amino acids)

>MMP_RS01895 flippase (Methanococcus maripaludis S2)
MDLKKKVLLNSSQLFGGQFLHSIISYAIVLMIGRTFGTEGLGQYSFIIAFTAFVAYIADF
GIEYYLLREIAKDNQNYDLISKSFGIKVFLGILCWFLIVFLTIFINKDPLVKLAIIIYGL
ASICSSIGLLFKSIIHANMVSKYESISILTERILTLIVGGVLLYFTKNLFLFMVVLTLDI
FILNILRYNYASKYAKIRLKFNLKDGINILKKSYFFWFIYVFSFIYYNTDILMLGIMQSD
SSVGIYRGGYFFIQAAMIIPVVVISTVMPSISILHTENRELLKTLFKKAFIFLSFLGISL
NLVLFIGSQSFIGLFFGNEFVESILVLQIMSFSIISIFLNSLYGSLLNATGNEKKYAKVL
GFSAILNVCLNFLLIPSMSYAGVAVSTLISNWVVTVILMFSCGRVINLKRL