Protein Info for MMP_RS01890 in Methanococcus maripaludis S2

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF02737: 3HCDH_N" amino acids 8 to 88 (81 residues), 29.1 bits, see alignment E=2.8e-10 PF03446: NAD_binding_2" amino acids 8 to 148 (141 residues), 28.7 bits, see alignment E=3.7e-10 PF01210: NAD_Gly3P_dh_N" amino acids 8 to 119 (112 residues), 25.2 bits, see alignment E=4.4e-09 TIGR03026: nucleotide sugar dehydrogenase" amino acids 8 to 414 (407 residues), 402.7 bits, see alignment E=7.9e-125 PF03721: UDPG_MGDP_dh_N" amino acids 8 to 190 (183 residues), 136.7 bits, see alignment E=2.1e-43 PF00984: UDPG_MGDP_dh" amino acids 208 to 295 (88 residues), 78.9 bits, see alignment E=7.5e-26 PF03720: UDPG_MGDP_dh_C" amino acids 322 to 417 (96 residues), 81.4 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0353)

Predicted SEED Role

"UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0B8 at UniProt or InterPro

Protein Sequence (435 amino acids)

>MMP_RS01890 nucleotide sugar dehydrogenase (Methanococcus maripaludis S2)
MNELGNLKIAVFGQGKMGLPLASVFAEYGINVIGVDINQMVVDNLNNGINHITEEPGLSE
LVSKNVENKKYTATTDGVGAATDADIIVILVPTLIDDRGNIKLDPVYSVSEIISKGLKKG
NIVITEATMPPGTTEKLIPILEKSGLKLGEFGLAHAPERTMTGTALRDIKGQYPKIIGCS
DERTHNIVSKLYDLINKKGTIKMSSIKAAETVKVFEGVYRDVNIGLSNEMALWCEEHSIN
ALEVFEAANTQPFCHFHTPGAGVGGHCIPVYPWFVINTSNEVNPRITKTARELNDYMAHH
IVELTIKGLNEFKKCLNGSKILVLGLTFRGGVKEFMKSAAIPIINELNSLGANVYSYDPL
CDELDAKKYNSKLKTDFNGIDAIIVTSDHEEFKHLDFEKISKEVSTKLIVDGRNIINVSN
ATENGFRVIKVGNLK