Protein Info for MMP_RS01880 in Methanococcus maripaludis S2

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 9 to 360 (352 residues), 453.8 bits, E=4.8e-140
• PF01212: Beta_elim_lyase
  • amino acids 29 to 263 (235 residues), 28.4 bits, E=1e-10

Best Hits

Swiss-Prot: 40% identical to DESV_STRVZ: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase (desV) from Streptomyces venezuelae

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0351)

MetaCyc: 40% identical to dTDP-3-oxo-3,4,6-trideoxy-alpha-D-glucopyranose transaminase monomer (Streptomyces venezuelae)
RXN-12768 [EC: 2.6.1.106]

Predicted SEED Role

No annotation

MetaCyc Pathways

• dTDP-D-desosamine biosynthesis (1/6 steps found)
• superpathway of erythromycin biosynthesis (1/19 steps found)
• superpathway of megalomicin A biosynthesis (2/22 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.106

Sequence Analysis Tools

See Q6M0C0 at UniProt or InterPro

Protein Sequence (367 amino acids)

>MMP_RS01880 DegT/DnrJ/EryC1/StrS family aminotransferase (Methanococcus maripaludis S2)
MIPIAKPILGNEEISAVTDVLKSGMIAQGKEVELFEREFCEYHNVKYGLAVSNGTTALDV
ALKSLKVSSGDEVITTPFTFIASSNCILYQGAKTVFADIDEKTFNIDPNEVLENINSKTK
AIIAVHLYGQPADMKALREIADDHKLFLIEDAAQAHGAEFEGKKIGNFGDITTFSFYPTK
NMTSSEGGMVVTNNPEIAKISDLIRNHGQAEKYLHTALGYNFRMTNISAAIGRVQLKKVE
EWTEKRIKNAKELSKRLSKIDGLSIPYLDKRVRHVFHQYVLRVEADFSLSRDEFSRYLNE
NGVGTGIHYPIPVHNQPVYQNLGYDKDECPNSIDAAKKVLSLPVHPSVSLDDIEYITQKI
ENRGGVN