Protein Info for MMP_RS01875 in Methanococcus maripaludis S2

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00132: Hexapep" amino acids 15 to 48 (34 residues), 38.3 bits, see alignment 1e-13 amino acids 51 to 81 (31 residues), 30.6 bits, see alignment 2.9e-11 amino acids 102 to 136 (35 residues), 28.3 bits, see alignment 1.6e-10 PF14602: Hexapep_2" amino acids 36 to 68 (33 residues), 30.4 bits, see alignment 4e-11 amino acids 110 to 136 (27 residues), 19.6 bits, see alignment (E = 9.4e-08)

Best Hits

Swiss-Prot: 55% identical to FDTC_ANETH: dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose 3-N-acetyltransferase (fdtC) from Aneurinibacillus thermoaerophilus

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0350)

MetaCyc: 55% identical to dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose 3-N-acetyltransferase (Aneurinibacillus thermoaerophilus L420-91)
RXN-12806 [EC: 2.3.1.197]

Predicted SEED Role

"probable acetyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.197

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0C1 at UniProt or InterPro

Protein Sequence (196 amino acids)

>MMP_RS01875 N-acetyltransferase (Methanococcus maripaludis S2)
MGSYQAHPTAHVENNSKIGDNTRIWHFSHIRENSEIGKNCNLGKGVYIDTNVKIGNNVKI
QNNVSVYAGVEVEDDVFLGPHMVFTNDLYPRAFNNNWKIVRTKVKTGASIGANSTVVCGI
TIGNYAMIGSGSVVTKDVPDYALVYGNPARLNGFVCTCGKKLENMVEKTEKLVKYRCSNC
STIVEIKKEDHDLLGD