Protein Info for MMP_RS01825 in Methanococcus maripaludis S2

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 158.2 bits, see alignment E=3.2e-50 TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit" amino acids 1 to 443 (443 residues), 694.1 bits, see alignment E=4.2e-213 PF02655: ATP-grasp_3" amino acids 115 to 293 (179 residues), 28.9 bits, see alignment E=4.1e-10 PF02786: CPSase_L_D2" amino acids 116 to 321 (206 residues), 274.4 bits, see alignment E=2.1e-85 PF02222: ATP-grasp" amino acids 136 to 292 (157 residues), 36.8 bits, see alignment E=1.2e-12 PF07478: Dala_Dala_lig_C" amino acids 136 to 290 (155 residues), 51.4 bits, see alignment E=3.7e-17 PF08443: RimK" amino acids 138 to 312 (175 residues), 28.6 bits, see alignment E=3.8e-10 PF02785: Biotin_carb_C" amino acids 335 to 441 (107 residues), 132.6 bits, see alignment E=2.2e-42

Best Hits

Swiss-Prot: 70% identical to PYCA_METJA: Pyruvate carboxylase subunit A (pycA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01959, pyruvate carboxylase subunit A [EC: 6.4.1.1] (inferred from 100% identity to mmp:MMP0341)

MetaCyc: 100% identical to pyruvate carboxylase subunit A (Methanococcus maripaludis)
Pyruvate carboxylase. [EC: 6.4.1.1]

Predicted SEED Role

"Pyruvate carboxyl transferase subunit A (EC 6.4.1.1)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 6.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.1

Use Curated BLAST to search for 6.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0D0 at UniProt or InterPro

Protein Sequence (501 amino acids)

>MMP_RS01825 acetyl-CoA carboxylase biotin carboxylase subunit (Methanococcus maripaludis S2)
MFKKVLIANRGEIAVRVIRACKELGIKTVAVFSEADEHSLYRNIADECYPIGEPPASKSY
LNMERILKVAEKAGVDAVHPGYGFLSENVKFADECHKRGIEFIGPPTNAIDVMGSKINAK
KAMKTAGVPVLPGREESIESEEEAIEVADEIGYPVIIKASAGGGGIGMNVVYNKEELVDT
IQSTKSIAQSAFGDSTVFIEKYLEKPRHIEIQVVADKFGNVIHLGDRECSIQRRHQKLIE
ESPSPIMTEELRERMGNAAVKAAKAINYHSVGTVEFLYSKGEFYFLEMNTRVQVEHPITE
VVTGVDIVKEQIKIAAGKKLSYTQDEITFRGHAIECRVNAEDAINDFVPAPGKIKYYRSP
GGPGVRLDSGVFGGAEIPPYYDSMVAKIITYGLTREEAIERMKRALSEYMVLGIITNIPF
HRAVIEEDNFLKGNLSTHYVEDNLCSFRKAMVNYALEAKDREKIFSEKVFHGNKKVIAIA
GGLNAYITSLSNKNKDKYDKN