Protein Info for MMP_RS01805 in Methanococcus maripaludis S2

Annotation: NUDIX hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 45 to 162 (118 residues), 82.5 bits, E=1.4e-27

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to mmp:MMP0339)

Predicted SEED Role

"ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.13)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.13

Sequence Analysis Tools

See Q6M0D2 at UniProt or InterPro

Protein Sequence (171 amino acids)

>MMP_RS01805 NUDIX hydrolase (Methanococcus maripaludis S2)
MEYNLLLKIKDESMEKEVLDELLNFLDKKYAGKVVAEPYRRINLTVDILIKYNFGIVLIK
RKNEPYKDYWAVPGGFVEYGERVEEAAKREAKEETGLNIDNLTLIGVYSDPNRDSRGHTV
TVAFLADGIGTLKSGSDAKDARIFNLDELNGVDFAFDHKKLINDSIHYIFD