Protein Info for MMP_RS01790 in Methanococcus maripaludis S2

Annotation: restriction endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF04471: Mrr_cat" amino acids 8 to 74 (67 residues), 27.6 bits, see alignment E=2.7e-10 PF01870: Hjc" amino acids 11 to 94 (84 residues), 91.2 bits, see alignment E=3.3e-30

Best Hits

Swiss-Prot: 56% identical to HJC_METJA: Holliday junction resolvase Hjc (hjc) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03552, holliday junction resolvase, archaea type (inferred from 100% identity to mmp:MMP0336)

Predicted SEED Role

"Uncharacterized protein MJ0497"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0D5 at UniProt or InterPro

Protein Sequence (135 amino acids)

>MMP_RS01790 restriction endonuclease (Methanococcus maripaludis S2)
MAHKYQKGSTFERELKKKLESHGFAVIRSAGSHGVDLVAGKKGKKPIVIECKSTSKDKYY
IPNEDVEKLLEFSKTFDGIPFIALKINRKCLFINPHLLTSAGKNYALDYEKLCPIALDIK
DVAEDSIQKKLDSEM