Protein Info for MMP_RS01765 in Methanococcus maripaludis S2

Annotation: HIT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 2 to 101 (100 residues), 60.8 bits, E=1.8e-20
• PF01230: HIT
  • amino acids 10 to 104 (95 residues), 106.4 bits, E=1.1e-34

Best Hits

Swiss-Prot: 53% identical to Y866_METJA: Uncharacterized HIT-like protein MJ0866 (MJ0866) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 96% identity to mmz:MmarC7_1333)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

See Q6M0E0 at UniProt or InterPro

Protein Sequence (130 amino acids)

>MMP_RS01765 HIT family protein (Methanococcus maripaludis S2)
MCIFCDIVKGDIPARIIYEDDKFLAFMDAFPRAVGHTLIIPKEHFETFDELPKELACEMM
EVIHKIVKKLEKLEMDGYNLLNNNKQVSGQEVPHVHFHIIPRYENEGYPVYVLKDPINVD
LDSIYDRIME