Protein Info for MMP_RS01725 in Methanococcus maripaludis S2

Annotation: class I SAM-dependent methyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF18093: Trm5_N" amino acids 4 to 48 (45 residues), 62.6 bits, see alignment 4.3e-21 PF02475: Met_10" amino acids 100 to 294 (195 residues), 223.7 bits, see alignment E=3.9e-70 PF06325: PrmA" amino acids 198 to 292 (95 residues), 25.2 bits, see alignment E=2.3e-09 PF09445: Methyltransf_15" amino acids 203 to 259 (57 residues), 26.5 bits, see alignment E=8.6e-10

Best Hits

Swiss-Prot: 62% identical to TRM5B_METJA: tRNA (guanine(37)-N1)-methyltransferase Trm5b (trm5b) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07055, (no description) (inferred from 100% identity to mmp:MMP0323)

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0E8 at UniProt or InterPro

Protein Sequence (342 amino acids)

>MMP_RS01725 class I SAM-dependent methyltransferase family protein (Methanococcus maripaludis S2)
LVFCIKVNFKLGEKTRKIMLDNHLLSKSYKLKKEGEFLYIPLTSSNFDKKIFEDENIEFE
ISELDENEISKINSEKKTSFKDYLLKNFKDEVEGNSIAHAYDIVGDIVILQISEEITPEI
RKKIGENALKLIPSVKAVFRRESDVKGDFRVRDLEHLAGEEKTLTLYKENGYRLLVDVAK
VYFSPRLGWERKRIMDLVTFDDIVVDMFCGVGPYSIACKNAEKIYSIDINPDGIELLKQN
IVLNNLENKIVPILEDVRNVDVKGTRVIMNLPKYAHQFVDKALEIVEDGGTIHYYTVGAD
FDEGIELFKSKCECEILDKRIVKSYSPREYVFVIDFKILKKN