Protein Info for MMP_RS01720 in Methanococcus maripaludis S2

Annotation: replication factor C large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF03215: Rad17" amino acids 2 to 70 (69 residues), 37.4 bits, see alignment E=8e-13 PF05673: DUF815" amino acids 5 to 91 (87 residues), 24.3 bits, see alignment E=5e-09 PF05496: RuvB_N" amino acids 9 to 67 (59 residues), 29.2 bits, see alignment 2.3e-10 PF00004: AAA" amino acids 42 to 141 (100 residues), 54.7 bits, see alignment E=4.5e-18 PF21960: RCF1-5-like_lid" amino acids 167 to 207 (41 residues), 35.6 bits, see alignment 2.2e-12

Best Hits

Swiss-Prot: 100% identical to RFCL_METMP: Replication factor C large subunit (rfcL) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K04800, replication factor C large subunit (inferred from 100% identity to mmp:MMP0322)

Predicted SEED Role

"Replication factor C large subunit" in subsystem DNA replication, archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0E9 at UniProt or InterPro

Protein Sequence (486 amino acids)

>MMP_RS01720 replication factor C large subunit (Methanococcus maripaludis S2)
MEEWVEKYRPKSLNDVAGHNKTKQALIEWIESIIGGQNQKPILLAGPPGSGKTTLAYAIA
NDYAFDVIELNASDKRNKDVISQVVGTAATSKSLTGRRTLIVLDEVDGLSGNDDRGGVAE
IIKVLKTAENPVILTANDVYKPALMTLRNSVNLINVGSVHTNSIPPVLRRIALKEGFEID
EKIIKMIASHSGGDLRAAINDLQSLATGGSIEIEDAKELPDRDSEKSIFDAMRIIMKTTH
YDIATSATRDVKEDIGTIEEWISENLPKEYLKYKDLAEGYDYLSKSDVFLGRVYRRQYFG
LWRYASALMTAGTALAKEEKYRGFTRYGPPAIFTKLSRTKGSRQKMKDILKKIALKTHTS
TKRARNTVDYLTVIFESNAEVSAELVEYYELTKDEIEFLTNKTITKKILSVIAGKKPKVK
KETPKKTEKPKEVMPIIPKRPRISEPPKEPLKEVIEETLEKSVEKADTKEEKKKDPKKQA
TLDSFF