Protein Info for MMP_RS01635 in Methanococcus maripaludis S2

Annotation: thiamine pyrophosphate-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02177: 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family
  • amino acids 15 to 281 (267 residues), 359.9 bits, E=5.6e-112
• PF02775: TPP_enzyme_C
  • amino acids 54 to 196 (143 residues), 103.2 bits, E=1.2e-33
• PF12367: PFO_beta_C
  • amino acids 200 to 260 (61 residues), 82 bits, E=2.6e-27

Best Hits

KEGG orthology group: K00175, 2-oxoglutarate ferredoxin oxidoreductase subunit beta [EC: 1.2.7.3] (inferred from 100% identity to mmp:MMP0305)

Predicted SEED Role

"2-oxoglutarate oxidoreductase, beta subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

• incomplete reductive TCA cycle (6/7 steps found)
• reductive TCA cycle I (6/11 steps found)
• TCA cycle V (2-oxoglutarate synthase) (4/9 steps found)
• reductive TCA cycle II (5/12 steps found)
• TCA cycle VI (Helicobacter) (2/9 steps found)
• TCA cycle VII (acetate-producers) (2/9 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)

KEGG Metabolic Maps

• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

See Q6M0G6 at UniProt or InterPro

Protein Sequence (286 amino acids)

>MMP_RS01635 thiamine pyrophosphate-dependent enzyme (Methanococcus maripaludis S2)
MENSSFQRNEKLDISWCPGCGNFAIKASLSNALTELNLKPENVAIISGIGQAGKMPHYIR
VNGFHTLHGRAIPAATAVKATNPNLTVIAEGGDGDMYAEGGNHLIHAIRRNPNITVLIHN
NQIYGLTKGQASPTTLISTKTPTQPWGVFEEPLNPIALAISLNASFVARTFSGNLEKTKE
IIIKAINHKGLSIVDIFHPCPSFNKLNTLQWYKENTYFLEDHDVTNRKKAFEKSLETEKY
PLGIFYTCEKPVFEEVVPPYISEKTPIWKREPNLEKIEEIINLKRS