Protein Info for MMP_RS01600 in Methanococcus maripaludis S2

Annotation: 50S ribosomal protein L15e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF00827: Ribosomal_L15e" amino acids 2 to 189 (188 residues), 288.8 bits, see alignment E=8.7e-91

Best Hits

Swiss-Prot: 100% identical to RL15E_METMP: 50S ribosomal protein L15e (rpl15e) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02877, large subunit ribosomal protein L15e (inferred from 100% identity to mmp:MMP0298)

Predicted SEED Role

"LSU ribosomal protein L15e" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61370 at UniProt or InterPro

Protein Sequence (194 amino acids)

>MMP_RS01600 50S ribosomal protein L15e (Methanococcus maripaludis S2)
MSMYNYVKEAWKVPANSYVKELQWARMQDWRKEPSVLRIERPTRIDRARNLGYKAKQGIV
VVRVSVRRGGLRKPRPKHSKKPATLGINKITMAKSIQRIAEERAAKRYPNMEVLNSYWVG
QDGKQKWYEIILVDPCHPSIKNDKSYSWLSTGNHKGRANRGLTSAGKKGRGLMYKGKGAE
KARPGVRANGKKTK