Protein Info for MMP_RS01585 in Methanococcus maripaludis S2

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00191: homoserine kinase" amino acids 4 to 281 (278 residues), 276.9 bits, see alignment E=7.5e-87 PF00288: GHMP_kinases_N" amino acids 65 to 148 (84 residues), 69.6 bits, see alignment E=2.1e-23 PF08544: GHMP_kinases_C" amino acids 206 to 283 (78 residues), 35.9 bits, see alignment E=8.3e-13

Best Hits

Swiss-Prot: 100% identical to KHSE_METMP: Homoserine kinase (thrB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 100% identity to mmp:MMP0295)

MetaCyc: 61% identical to homoserine kinase monomer (Methanocaldococcus jannaschii)
Homoserine kinase. [EC: 2.7.1.39]

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0H5 at UniProt or InterPro

Protein Sequence (301 amino acids)

>MMP_RS01585 homoserine kinase (Methanococcus maripaludis S2)
MKKVKVCSPGTSANLGPGYDIFGLALSNPYDIVEVEKTENGITISVEGEKAEEIPTNVDE
NTAGVVAKKMIEDFKIESGIHIHIIKGIKPGSGLGSSSASCAGIAFALNELFELKLSKLE
LVKYSSLGEAVAAGAPHADNVAPAIFGGFTLTTSYEPLEVLHIPVDLEVLVALPNIQVST
KTAREILPKEIPIKDMVNNVGKAAGMVYALYNNDLDLFGRYMSKDCVVEPCRANLIDGYT
EVKEKVKDMVYGITISGSGPAIITIPKKEHVIDIENIFKEVWNCPVYYTKVGPGCYVEEI
E