Protein Info for MMP_RS01545 in Methanococcus maripaludis S2

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00571: CBS" amino acids 5 to 54 (50 residues), 42.4 bits, see alignment 7.3e-15 amino acids 62 to 117 (56 residues), 41.2 bits, see alignment E=1.7e-14 PF02195: ParBc" amino acids 147 to 224 (78 residues), 53.3 bits, see alignment E=2.5e-18

Best Hits

Swiss-Prot: 58% identical to Y188_METJA: Uncharacterized protein MJ0188 (MJ0188) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to mmp:MMP0287)

Predicted SEED Role

"CBS/parB domain-containing protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0I3 at UniProt or InterPro

Protein Sequence (264 amino acids)

>MMP_RS01545 CBS domain-containing protein (Methanococcus maripaludis S2)
MVYAEEYMTKKVHSITPDATVSDIIKLVKETTHDTFPVVVNSKVKGIVSVHDLIGKDELD
EVSEFMTPRDDMIVTKPHTKIMDVGRIMFRTGFSKLPIVDENNNILGIITNTDVIRSQIE
KTTPKKLKKIVNSYINLGYEVTTKRETIQIDDLIPTQANVYEDELYGRAYELKRGLAEPI
IVIKTNVNEKYILVDGHHRAVAACLSNIKELEAHVLEINTDKTMGIEKTAEKQGLKSLKD
IKILDEEKMNCSSAYKLRANILEL