Protein Info for MMP_RS01530 in Methanococcus maripaludis S2

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 TIGR00491: translation initiation factor aIF-2" amino acids 6 to 600 (595 residues), 932.9 bits, see alignment E=7.2e-285 PF00009: GTP_EFTU" amino acids 9 to 218 (210 residues), 111.7 bits, see alignment E=8.7e-36 TIGR00231: small GTP-binding protein domain" amino acids 9 to 150 (142 residues), 67.3 bits, see alignment E=1.4e-22 PF01926: MMR_HSR1" amino acids 11 to 134 (124 residues), 32 bits, see alignment E=2.9e-11 PF11987: IF-2" amino acids 338 to 448 (111 residues), 72.9 bits, see alignment E=5.5e-24 PF14578: GTP_EFTU_D4" amino acids 469 to 556 (88 residues), 93.8 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 100% identical to IF2P_METMP: Probable translation initiation factor IF-2 (infB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03243, translation initiation factor 5B (inferred from 100% identity to mmp:MMP0284)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0I6 at UniProt or InterPro

Protein Sequence (601 amino acids)

>MMP_RS01530 translation initiation factor IF-2 (Methanococcus maripaludis S2)
VIFMALRCPIVSVLGHVDHGKTSLLDKIRRTRVTQREAGGITQHIGASEIPINTIKKVSK
DLLGLFKADLSIPGILVIDTPGHEAFTSLRKRGGALADIAILVVDINEGFKPQTIEAINI
LKQCKTPFVVAANKVDRIPGWNSSEGPFILNFNEKNQHPNAMTEFEIRLYENVIKHLNEL
GFDADLFSRVKDTTKTINVVPVSAMTGEGVPDLLVIISGLAQRFLEQKLALNVEGYAKGT
VLELKEEKGLGKTIDAIIYDGIAKTGDFLVVGNPDGVLVSKIKALLKPKELDEMRDPKDK
FKPSKQISAATGVKISAPDLDSVIAGSPLRIVPKNQVEAAKEEVLEEVEEFTILTDDEGI
IIKADTMGSLEALANELRKVNAKIKKAEVGDISKKDVIEASSYASTNPLNGLIISFNTKV
LADAKAEIEKSDVKLLEGKIIYKLVEEHEEWTKEMEELMKSDEINRLTKPAMIKILPNCI
FRQKEPAVCGVEVLYGTLKIGSPIMSEDGKKLGYVKEMRDNQQENIKEAKVGMQVPVSID
GNIVLGRNAKENDILYVEVPEPEARKLHHEFKDELRGDEKEALSRYMELKQKIENNIFWG
M