Protein Info for MMP_RS01495 in Methanococcus maripaludis S2

Annotation: TraB/GumN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 244 to 262 (19 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details PF01963: TraB_PrgY_gumN" amino acids 5 to 225 (221 residues), 110.6 bits, see alignment E=6.2e-36 TIGR00261: TraB family protein" amino acids 9 to 376 (368 residues), 412 bits, see alignment E=1.2e-127

Best Hits

Swiss-Prot: 53% identical to Y1365_METJA: Uncharacterized protein MJ1365 (MJ1365) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0277)

Predicted SEED Role

"Pheromone shutdown protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0J3 at UniProt or InterPro

Protein Sequence (380 amino acids)

>MMP_RS01495 TraB/GumN family protein (Methanococcus maripaludis S2)
MYIRVNNGVTECNIRLVGTAHVSDDSVKEVENAIIETDPEIVAIELDKDRFVAMFQNKKN
NVDLKSVIKQGKVGIYIVHSILANFQKNIGEQFGIKPGSEMKKATDLAIQHGKPISLIDR
PINVTLSRTVNKMTLKEKFDFLMGLLTEQNLELDEKAVNDMVSNADDLILLLKDISPSIY
ETLVDERDRYMAKNLFEASKGKENIVAVVGAGHVPGIKNYLKKMEIGEDIDLKSLMEIKK
KSNVLGKLISIAILLIILYGFYTASSNLEALKTLTMEWVLINGCLSSLGVILARGKIHTI
IAAFLAAPVTSLIPVVGAGYVAGLVELKFRDVSFNDIGKMMNTENFKELMENQAMRVLLV
AALANLGSAIGTFYFVPRFL