Protein Info for MMP_RS01370 in Methanococcus maripaludis S2

Annotation: acetate--CoA ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 PF02629: CoA_binding" amino acids 9 to 102 (94 residues), 53.5 bits, see alignment E=8.5e-18 PF13380: CoA_binding_2" amino acids 11 to 135 (125 residues), 85.3 bits, see alignment E=1.1e-27 PF13607: Succ_CoA_lig" amino acids 153 to 288 (136 residues), 176.9 bits, see alignment E=4.6e-56 PF19045: Ligase_CoA_2" amino acids 300 to 450 (151 residues), 55.2 bits, see alignment E=2.2e-18 PF13549: ATP-grasp_5" amino acids 490 to 689 (200 residues), 183.7 bits, see alignment E=8.3e-58

Best Hits

Swiss-Prot: 53% identical to ACD_METJA: Acetate--CoA ligase [ADP-forming] (MJ0590) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01905, acetyl-CoA synthetase (ADP-forming) [EC: 6.2.1.13] (inferred from 100% identity to mmp:MMP0253)

Predicted SEED Role

"Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0L7 at UniProt or InterPro

Protein Sequence (702 amino acids)

>MMP_RS01370 acetate--CoA ligase family protein (Methanococcus maripaludis S2)
MNTLEGIFNPKSVAVIGASEIEGKVGQSVMKNLLNFKQHGGKVYPINKKYNEVYGIKCYG
SVLDVPETPDLVIISIPAEYAVDAMEECGRKGVKAAIIITAGFAETNNHVLEDRLKAIID
QYGIRTIGPNCLGVINLHNHLNASFSKEFSNMGNIAFISQSGAIMTALLDIANYYNLGFS
KIVSMGNKIDVQEYELLNYLENDPHTKVVALYIEGLKDEKFISAAKKISRKKPVIVLKSG
KSEEGAKAASSHTGSLAGNNAVYDAAFKKSRVFNVESFEDLVNLLKIFSVQPPMKSKKLA
VITNAGGFGVLAADSVEKCGLELADFSATTISELKKYLPDTSGISNPLDLIGDADVNRYK
HAFELVENDPNVDGLLAILTPQGMTDALGVARELVKLKNYMICKKDKIPIVASFVGGTSV
LEARSYLQEKGIPSFICPELAVHALACLYRQSHLMDKYDSPEYLNEIRSEIAEAKANNPE
KIDELLANANESNSKEFLKLNGFAIPEKFVATTKEEAKEYAENLGKVVMKVVSADILHKS
DAGCVIIDPSDASEAFETIMKNGEKYLFDRKIDGIIDGVLIEQFVTGKEIIIGAKRDPVF
GPVVMTGLGGIFVEVLKDVSFGITPITKEYAGEILHSLKSYKILEGVRGENRSDIEFLKE
LIVRVGVLMETYDEISEIDINPAFIKEEGQGGFVGDALIITK