Protein Info for MMP_RS01355 in Methanococcus maripaludis S2

Annotation: 50S ribosomal protein L37Ae

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 TIGR00280: ribosomal protein eL43" amino acids 4 to 92 (89 residues), 135.6 bits, see alignment E=2.9e-44 PF01780: Ribosomal_L37ae" amino acids 6 to 89 (84 residues), 113 bits, see alignment E=2.9e-37

Best Hits

Swiss-Prot: 100% identical to RL37A_METMP: 50S ribosomal protein L37Ae (rpl37ae) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02921, large subunit ribosomal protein L37Ae (inferred from 96% identity to mmx:MmarC6_0704)

Predicted SEED Role

"LSU ribosomal protein L37Ae" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0M1 at UniProt or InterPro

Protein Sequence (96 amino acids)

>MMP_RS01355 50S ribosomal protein L37Ae (Methanococcus maripaludis S2)
MVEFSHTKKIGSAGRFGSRYGRKIRVRLRDVEIKQNKDYKCPVCAFPKLKRAGTSIWVCE
KCGAKIAGGAYTPETGAGKVVTKAIRRVIESKSREI