Protein Info for MMP_RS01325 in Methanococcus maripaludis S2

Annotation: dihydroneopterin aldolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04038: DHNA
  • amino acids 20 to 122 (103 residues), 131.4 bits, E=9.9e-43

Best Hits

Swiss-Prot: 62% identical to MPTD_METJA: Dihydroneopterin aldolase (mptD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K09739, hypothetical protein (inferred from 100% identity to mmp:MMP0243)

MetaCyc: 62% identical to dihydroneopterin aldolase monomer (Methanocaldococcus jannaschii)
Dihydroneopterin aldolase. [EC: 4.1.2.25]

Predicted SEED Role

"Uncharacterized protein MJ0408"

MetaCyc Pathways

• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (5/7 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (2/5 steps found)
• superpathway of tetrahydrofolate biosynthesis (4/10 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (5/12 steps found)
• tetrahydromethanopterin biosynthesis (6/14 steps found)
• superpathway of chorismate metabolism (25/59 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25

Sequence Analysis Tools

See Q6M0M7 at UniProt or InterPro

Protein Sequence (124 amino acids)

>MMP_RS01325 dihydroneopterin aldolase family protein (Methanococcus maripaludis S2)
MSEKSLEKNEIFDSYFKNLSDRERAVFEGGISLGALFHQFIGTPVSEKTKKSLEIAMSES
LKNQPFIEDVSVSIVGIIEDGKYVSLTGEMLDVSLTVKTEKNRALLRLKYIKELDYPLMY
VEKI