Protein Info for MMP_RS01255 in Methanococcus maripaludis S2

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 165 (149 residues), 144.9 bits, E=3.7e-46

Best Hits

Swiss-Prot: 62% identical to GLNQ_BACSU: Glutamine transport ATP-binding protein GlnQ (glnQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to mmp:MMP0229)

MetaCyc: 62% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamine transport ATP-binding protein GlnQ (TC 3.A.1.3.2)" (TC 3.A.1.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

See F1SVF5 at UniProt or InterPro

Protein Sequence (243 amino acids)

>MMP_RS01255 amino acid ABC transporter ATP-binding protein (Methanococcus maripaludis S2)
LIEMVNIHKKFKEAHVLKGVDLKVAKGEVLVIVGPSGSGKSTLLRCINGLEKTTEGHIFF
EGDDITDKKVNINKIRQKIGMVFQQFNLFPHLTVLDNITFAPRKVLNVSKKEAEELAREL
LKKVGLEGKENQYPIQLSGGQQQRVAIARALAMKPDAMLFDEPTSALDPELVKEVLDVMK
QLAYEGMTMVVVTHEMGFAKEVGDRLIFIDDGQILEDGNPSDVFSNPKNERTKNFFGKIL
SHN