Protein Info for MMP_RS01230 in Methanococcus maripaludis S2

Annotation: glutamate-1-semialdehyde 2 1-aminomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR00713: glutamate-1-semialdehyde-2,1-aminomutase" amino acids 10 to 425 (416 residues), 629.3 bits, see alignment E=1.3e-193 PF00202: Aminotran_3" amino acids 34 to 398 (365 residues), 251.7 bits, see alignment E=5.6e-79

Best Hits

Swiss-Prot: 100% identical to GSA_METMP: Glutamate-1-semialdehyde 2,1-aminomutase (hemL) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01845, glutamate-1-semialdehyde 2,1-aminomutase [EC: 5.4.3.8] (inferred from 100% identity to mmp:MMP0224)

Predicted SEED Role

"Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 5.4.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0P5 at UniProt or InterPro

Protein Sequence (427 amino acids)

>MMP_RS01230 glutamate-1-semialdehyde 2 1-aminomutase (Methanococcus maripaludis S2)
VELNIKMDRSKELFEESKKYLVGGVNSPVRLFKPFPFFVKSAKDCFLYDEDGNEFIDYCL
AYGPMVLGHANENILNAVKSQMDLGTAYGVPSEKEITLAKEVINRIPCAEMVRFVNSGTE
ATMGAIRLARGVTKRNKIIKFEGAFHGAHDYVLVKTGSGALTHGAPNSPGIPEDTTKNTL
LIPFNDEEAVRKVISENKEEIACIILEPVMGNVGCIPPKDGYLQFLREITEENGILLIFD
EVITGFRLSKGGAQEYYGIKSDLATVGKILGGGFPIGAITGKKEYMEQFSPNGQIYQAGT
FNGNPISVTAGIETLKNLDDKFYKETTKKAGILSNCLRETAEKYNIPAKVYNVASIFQVY
FNDKEIVTYEDAKSSDTEKFMKYFYTLLENGVFVAPSQFECCFTSIKHNDEVLEKTMNAI
DIAMKKL