Protein Info for MMP_RS01180 in Methanococcus maripaludis S2

Annotation: XTP/dITP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 2 to 180 (179 residues), 207.9 bits, E=4.3e-66
• PF01725: Ham1p_like
  • amino acids 3 to 178 (176 residues), 164.6 bits, E=1.3e-52

Best Hits

Swiss-Prot: 69% identical to IXTPA_METJA: dITP/XTP pyrophosphatase (MJ0226) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 100% identity to mmp:MMP0214)

Predicted SEED Role

"Xanthosine/inosine triphosphate pyrophosphatase" in subsystem Folate Biosynthesis or Heat shock dnaK gene cluster extended

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (7/9 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (6/9 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (8/14 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

See Q6M0Q5 at UniProt or InterPro

Protein Sequence (183 amino acids)

>MMP_RS01180 XTP/dITP diphosphatase (Methanococcus maripaludis S2)
MKIYFATGNQNKVDEAEIILKEANCEIEQIEIPYAEVQGRLEEVSAFGVLEVFEKFNRPV
IVEDSGFFIEKLNDFPGTYSRFVQETIGNEGILKLLENETNRNAYFKTVIGYYDGDNIKL
FTGIVKGTISTEIKDGGFGFAYDSIFIPEGKTKTFAEMTTEEKSEISHRKRAFYELKNYL
ENL