Protein Info for MMP_RS01160 in Methanococcus maripaludis S2

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 40 to 57 (18 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details PF00892: EamA" amino acids 12 to 143 (132 residues), 78.3 bits, see alignment E=3.3e-26 amino acids 158 to 294 (137 residues), 85.6 bits, see alignment E=1.8e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0210)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0Q9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>MMP_RS01160 DMT family transporter (Methanococcus maripaludis S2)
MKKLLKKYELFLLMIPAVFFGAGAFITGKIGILELSWDELTFLRFLIASAIILPLVLKKE
HKNLKLKKNDAYIVILAGLFGMFGYHALFFMSLEYITAINSALLMATTPMVTSIIAAVVL
GEYFGIKRIFAVFIAFFGVLLTITNGNLEVLKNLSFNIGDVIMFSAVLCMALYAVLSKKV
AQKYSPSLILTYGYILTVVLLIPYMILKNPINVILNASLETWLSIIYMAVFASVLAQLLQ
QISLKYHGASKTMLFYQFVPIIVIGLSAIFLKEPFTKITAISTLFIMGGVYINSTIKRD