Protein Info for MMP_RS01140 in Methanococcus maripaludis S2
Annotation: molybdate ABC transporter permease subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to YVGM_BACSU: Putative molybdenum transport system permease protein YvgM (yvgM) from Bacillus subtilis (strain 168)
KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to mmp:MMP0206)Predicted SEED Role
"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6M0R3 at UniProt or InterPro
Protein Sequence (221 amino acids)
>MMP_RS01140 molybdate ABC transporter permease subunit (Methanococcus maripaludis S2) MDSIVFPLVLTLKISFISTFFVVIFGVILSYILARKSFYGRDILENIVTLPMVLPPTVLG YLLALQLGKNGFIGSLIYKFTGSGILFTWQAAVIAAFIVSFPLMVKTTTAAISAVDRELE YVSYTLGKTELQTIYKITLPLSKKGIVAGAILSFARAVGEFGATLMVAGNLPGKTNTMSL SIYQAFQTGNYDLANVLVVLLIIMSFLTIFLTGRFVEKWKF