Protein Info for MMP_RS01120 in Methanococcus maripaludis S2

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 31 to 33 (3 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details PF03773: ArsP_1" amino acids 27 to 315 (289 residues), 253.2 bits, see alignment E=1.6e-79

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to mmp:MMP0202)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0R7 at UniProt or InterPro

Protein Sequence (318 amino acids)

>MMP_RS01120 permease (Methanococcus maripaludis S2)
MFGWLDYGARYIVENILNMSMDTAIGSSVHFFIYDSLKIVILLSIMIFSISYIRSYFPPE
KTKKILERYSGVSGNIMASLLGTVTPFCSCSSVPIFIGFIEAGVPLGVTLSFLITSPIVN
EAAFAVLLASFGWQIAMIYVVSGVIIGVVGGLIIGKLGMENQVEEYVYSIRSRARKIKEL
TQKERLKFAYDSTRDIVKRVWLYILIGIGIGAIIHGYAPEEVLAKYAGPENPLAVIFATI
IAVPLYSNALGTIPIAEALIGKGVGIGTALAFMMATTALSFPEAVLLRKVIKPKLIAVFF
GITSIAIVITGYLFNILL