Protein Info for MMP_RS01100 in Methanococcus maripaludis S2

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 165 (149 residues), 107.3 bits, E=2.1e-34
• PF13304: AAA_21
  • amino acids 80 to 199 (120 residues), 29.9 bits, E=1.2e-10

Best Hits

Swiss-Prot: 36% identical to Y089_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0089 (MJ0089) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to mmp:MMP0198)

MetaCyc: 33% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

See Q6M0S1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>MMP_RS01100 ABC transporter ATP-binding protein (Methanococcus maripaludis S2)
MLRIENINFNYGKNKILNDCSFKLDSGIGCILGPNGAGKSTILKCISGIVPVKSGSITID
GEKTTQMKYKDRSRLISYSPQEFSINFPYTVFEVVLMGRNPHVNFLAGPSKKDEQKVTEI
LNLLKISHLKDKEFISLSGGQKRLVMIATALIQDAKLMIFDEPTSFLDYKNQYLVLSVIE
KISKEMNKTVLLSLHDPNLAFLFCDNLFLMKNGKILSEIADKNSVCPENFQELYGINTKF
ADIFGQKVVLPDKDYLKTMI