Protein Info for MMP_RS01095 in Methanococcus maripaludis S2

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF01032: FecCD" amino acids 11 to 312 (302 residues), 284.5 bits, see alignment E=4.8e-89

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to mmp:MMP0197)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0S2 at UniProt or InterPro

Protein Sequence (316 amino acids)

>MMP_RS01095 iron ABC transporter permease (Methanococcus maripaludis S2)
LNKNYVFPFLFAGVFLFSLFVGRYMFDPSLIFTNSLANNIFFDIRLPRAIAVSLAGASLA
LAGVSFQNIFKNYLAGPNILGVTSGSAFGASIAILFFAYNPYLVQFSAFIFGVIAVYIAY
KLSSLLKSGIVGLILSGMAISAFFSAMIGLIKYVADPYEKLPTIVFWLLGSFVGLRWVDL
GISVIPMLIGIIGLVMLKWVFNILATGDENAKSLGVDSKKLKNITIFLATLAASASTSLA
GMIQWVGVVSPHIARLLVGVDNRKLVPASAFVGATLLLLCDTLARTLTPSEIPISIITSF
IGAPILIIILSKRGVK