Protein Info for MMP_RS01060 in Methanococcus maripaludis S2

Annotation: calcium/sodium antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 70 to 95 (26 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 5 to 282 (278 residues), 214.8 bits, see alignment E=7.8e-68 PF01699: Na_Ca_ex" amino acids 6 to 144 (139 residues), 101.7 bits, see alignment E=1.9e-33 amino acids 165 to 316 (152 residues), 99.5 bits, see alignment E=9.5e-33

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to mmp:MMP0190)

Predicted SEED Role

"Uncharacterized membrane protein MJ0091"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0S9 at UniProt or InterPro

Protein Sequence (320 amino acids)

>MMP_RS01060 calcium/sodium antiporter (Methanococcus maripaludis S2)
MLGYLISYMIFGGILLAYGSDWFIEGSTRVAKHFNVSNFVIGATIVAFGTSLPEIVTSSG
AALSGYPGLAVGNAVGSCIANIGIILGISVLMYPLIIKKRAIIKNGNIYLIATILLVILG
YNGFSRFDGLILFLFMITYVIYTIKTSESDDEEIISDLTTKKASIFIVVGLLAVILGSDL
FIEGAKGIAEYFNVPESIIGFSLVAFGTSLPELASSVAAAKRKLGSIVLGNVIGSNIANT
CIALSFSAMIVDIPKYNVELMVNTIMALLIIFTMNREKIKKMLKFKNFRTDYFSKIDRID
GISYILIYLIFLAYLLGYIF