Protein Info for MMP_RS01040 in Methanococcus maripaludis S2

Annotation: phosphomethylpyrimidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00190: phosphomethylpyrimidine synthase
  • amino acids 1 to 423 (423 residues), 671.9 bits, E=1.6e-206
• PF01964: ThiC_Rad_SAM
  • amino acids 2 to 421 (420 residues), 644.8 bits, E=2.9e-198

Best Hits

Swiss-Prot: 100% identical to THIC_METMP: Phosphomethylpyrimidine synthase (thiC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03147, thiamine biosynthesis protein ThiC (inferred from 100% identity to mmp:MMP0187)

MetaCyc: 49% identical to 5-hydroxybenzimidazole synthase BzaB subunit (Moorella thermoacetica)
RXN-17122 [EC: 4.1.99.23]

Predicted SEED Role

"Thiamin biosynthesis protein ThiC" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• 5-hydroxybenzimidazole biosynthesis (anaerobic) (1/1 steps found)
• 5-methoxybenzimidazole biosynthesis (anaerobic) (1/2 steps found)
• 5-methoxy-6-methylbenzimidazole biosynthesis (anaerobic) (1/3 steps found)
• 5,6-dimethylbenzimidazole biosynthesis II (anaerobic) (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.23

Sequence Analysis Tools

See P61428 at UniProt or InterPro

Protein Sequence (426 amino acids)

>MMP_RS01040 phosphomethylpyrimidine synthase (Methanococcus maripaludis S2)
MTQMTDAKSGITTEEMKFVAKEEGMDVETLKNLIAKGYVVIPKNVNRNTKPVGIGDNLRT
KVNVNLGTSPDFIDIACELKKVEISNKYGADAIMDLSTGGNLPEIRKEIIKNTNLPIGTV
PIYEVGVDAKEKYGRVIDMDEDLIFNVIERQAKEGVDFMTLHCGITKQTVSALNNDPRKM
GVVSRGGAFLTAYIMYHDKENPLYKEFDYLLELLKEHDVTLSLGDGMRPGCLQDNTDRAQ
IQELITLGELVDKCREKGVQVMVEGPGHVPYNNIEANMKIQKTLCKNAPFYVLGPIVTDL
APGYDHITAAIGGTLAAVSGANFLCYVTPAEHVRLMKEDDVKEGLIASKIAAQAADVAKG
HPVAWKLEKEMADARIKHDWERQFEIALDSNKPRKMREEIPSKDEKACSVCGDYCALLMV
EELGKR